Interleukin-3 / IL3 Human Protein
Other products for "IL3"
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILM ENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHI KDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF N-terminal Sequence: MAPMTQT |
Predicted MW | 15 kDa |
Purity | >98% pure by SDS-PAGE & silver stain |
Buffer | Presentation State: Purified State: Lyophilized purified protein Buffer System: PBS Stabilizer: None |
Bioactivity | Biological: Recombinant human IL-3 is fully biologically active when compared to standards. The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is < 0.1-0.5 ng/ml. Specific: 1 x 107 units/mg |
Endotoxin | < 0.1 ng per µg (IEU/µg) of rh IL-3. |
Reconstitution | Restore in water to a concentration not less than of 0.1 mg/ml. This solution can be diluted into other buffered solutions or stored at -20°C for future use. For most in vitro applications, IL-3 exerts its biological activity in the concentration range of 0.1 to 1.0 ng/ml. |
Preparation | Lyophilized purified protein |
Protein Description | Recombinant Human IL-3 produced in E. coli is a 15.0 kDa globular protein containing 133 amino acid residues. |
Note | Centrifuge vial before opening! |
Storage | Store lyophilized at 2-8°C for 6 months or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C long term. Avoid repeated freezing and thawing. |
Stability | Shelf life: one year from despatch. |
Reference Data | |
RefSeq | NP_000579 |
Locus ID | 3562 |
UniProt ID | P08700 |
Cytogenetics | 5q31.1 |
Synonyms | IL-3; MCGF; MULTI-CSF |
Summary | 'The protein encoded by this gene is a potent growth promoting cytokine. This cytokine is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell activities such as cell growth, differentiation and apoptosis. This cytokine has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Apoptosis, Asthma, Cytokine-cytokine receptor interaction, Fc epsilon RI signaling pathway, Hematopoietic cell lineage, Jak-STAT signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.