Interleukin-3 / IL3 Human Protein

CAT#: DA3545S

Interleukin-3 / IL3 human recombinant protein, 2 µg


USD 155.00

2 Weeks*

Size
    • 2 ug

Product Images

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILM ENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHI KDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
N-terminal Sequence: MAPMTQT
Predicted MW 15 kDa
Purity >98% pure by SDS-PAGE & silver stain
Buffer Presentation State: Purified
State: Lyophilized purified protein
Buffer System: PBS
Stabilizer: None
Bioactivity Biological: Recombinant human IL-3 is fully biologically active when compared to standards.
The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is < 0.1-0.5 ng/ml.
Specific: 1 x 107 units/mg
Endotoxin < 0.1 ng per µg (IEU/µg) of rh IL-3.
Reconstitution Restore in water to a concentration not less than of 0.1 mg/ml.
This solution can be diluted into other buffered solutions or stored at -20°C for future use.
For most in vitro applications, IL-3 exerts its biological activity in the concentration range of 0.1 to 1.0 ng/ml.
Preparation Lyophilized purified protein
Protein Description Recombinant Human IL-3 produced in E. coli is a 15.0 kDa globular protein containing 133 amino acid residues.
Note Centrifuge vial before opening!
Storage Store lyophilized at 2-8°C for 6 months or at -20°C long term.
After reconstitution store the antibody undiluted at 2-8°C for one month 
or (in aliquots) at -20°C long term.
Avoid repeated freezing and thawing.
Stability Shelf life: one year from despatch.
Reference Data
RefSeq NP_000579
Locus ID 3562
UniProt ID P08700
Cytogenetics 5q31.1
Synonyms IL-3; MCGF; MULTI-CSF
Summary 'The protein encoded by this gene is a potent growth promoting cytokine. This cytokine is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell activities such as cell growth, differentiation and apoptosis. This cytokine has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders. [provided by RefSeq, Jul 2008]'
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Apoptosis, Asthma, Cytokine-cytokine receptor interaction, Fc epsilon RI signaling pathway, Hematopoietic cell lineage, Jak-STAT signaling pathway

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.