Interleukin-3 / IL3 Human Protein

CAT#: DA3545X

Interleukin-3 / IL3 human recombinant protein, 50 µg

Product Images

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILM ENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHI KDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

  N-terminal Sequence: MAPMTQT
• Predicted MW: 15 kDa
• Purity: >98% pure by SDS-PAGE & silver stain
• Buffer: Presentation State: Purified
  State: Lyophilized purified protein
  Buffer System: PBS
  Stabilizer: None
• Bioactivity: Biological: Recombinant human IL-3 is fully biologically active when compared to standards.
  The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is < 0.1-0.5 ng/ml.
  Specific: 1 x 10⁷ units/mg
• Endotoxin: < 0.1 ng per µg (IEU/µg) of rh IL-3.
• Reconstitution: Restore in water to a concentration not less than of 0.1 mg/ml.
  This solution can be diluted into other buffered solutions or stored at -20°C for future use.
  For most in vitro applications, IL-3 exerts its biological activity in the concentration range of 0.1 to 1.0 ng/ml.
• Preparation: Lyophilized purified protein
• Protein Description: Recombinant Human IL-3 produced in E. coli is a 15.0 kDa globular protein containing 133 amino acid residues.
• Note: Centrifuge vial before opening!
• Storage: Store lyophilized at 2-8°C for 6 months or at -20°C long term.
  After reconstitution store the antibody undiluted at 2-8°C for one month
  or (in aliquots) at -20°C long term.
  Avoid repeated freezing and thawing.
• Stability: Shelf life: one year from despatch.

Reference Data

• RefSeq: NP_000579
• Locus ID: 3562
• UniProt ID: P08700
• Cytogenetics: 5q31.1
• Synonyms: IL-3; MCGF; MULTI-CSF
• Summary: 'The protein encoded by this gene is a potent growth promoting cytokine. This cytokine is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell activities such as cell growth, differentiation and apoptosis. This cytokine has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Apoptosis, Asthma, Cytokine-cytokine receptor interaction, Fc epsilon RI signaling pathway, Hematopoietic cell lineage, Jak-STAT signaling pathway