DCXR (NM_016286) Human Recombinant Protein

CAT#: TP300023

Recombinant protein of human dicarbonyl/L-xylulose reductase (DCXR)


  View other "DCXR" proteins (6)

Special Offer: Get a 20% discount on this product. Use code: "MVPro20".

USD 823.00

In Stock*

Size
    • 20 ug

Product Images

Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


Anti-DCXR mouse monoclonal antibody, clone OTI4D11 (formerly 4D11)
    • 100 ul

USD 379.00

Other products for "DCXR"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC200023 protein sequence
Red=Cloning site Green=Tags(s)

MELFLAGRRVLVTGAGKGIGRGTVQALHATGARVVAVSRTQADLDSLVRECPGIEPVCVDLGDWEATERA
LGSVGPVDLLVNNAAVALLQPFLEVTKEAFDRSFEVNLRAVIQVSQIVARGLIARGVPGAIVNVSSQCSQ
RAVTNHSVYCSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTMLNRIPLGKFA
EVEHVVNAILFLLSDRSGMTTGSTLPVEGGFWAC

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 25.7 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_057370
Locus ID 51181
UniProt ID Q7Z4W1, A0A384NY14
Cytogenetics 17q25.3
Refseq Size 860
Refseq ORF 732
Synonyms DCR; HCR2; HCRII; KIDCR; P34H; PNTSU; SDR20C1; XR
Summary The protein encoded by this gene acts as a homotetramer to catalyze diacetyl reductase and L-xylulose reductase reactions. The encoded protein may play a role in the uronate cycle of glucose metabolism and in the cellular osmoregulation in the proximal renal tubules. Defects in this gene are a cause of pentosuria. Two transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Aug 2010]
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Pentose and glucuronate interconversions

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.