DCXR (NM_016286) Human Recombinant Protein

CAT#: TP300023

Recombinant protein of human dicarbonyl/L-xylulose reductase (DCXR)

Product Images

Coomassie blue staining of purified DCXR protein (Cat# TP300023). The protein was produced from HEK293T cells transfected with DCXR cDNA clone (Cat# RC200023) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200023 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MELFLAGRRVLVTGAGKGIGRGTVQALHATGARVVAVSRTQADLDSLVRECPGIEPVCVDLGDWEATERA
  LGSVGPVDLLVNNAAVALLQPFLEVTKEAFDRSFEVNLRAVIQVSQIVARGLIARGVPGAIVNVSSQCSQ
  RAVTNHSVYCSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTMLNRIPLGKFA
  EVEHVVNAILFLLSDRSGMTTGSTLPVEGGFWAC
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 25.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057370
• Locus ID: 51181
• UniProt ID: Q7Z4W1, A0A384NY14
• Cytogenetics: 17q25.3
• Refseq Size: 860
• Refseq ORF: 732
• Synonyms: DCR; HCR2; HCRII; KIDCR; P34H; PNTSU; SDR20C1; XR
• Summary: The protein encoded by this gene acts as a homotetramer to catalyze diacetyl reductase and L-xylulose reductase reactions. The encoded protein may play a role in the uronate cycle of glucose metabolism and in the cellular osmoregulation in the proximal renal tubules. Defects in this gene are a cause of pentosuria. Two transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Aug 2010]
• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Pentose and glucuronate interconversions