ZAK (MAP3K20) (NM_133646) Human Recombinant Protein
CAT#: TP300069
Recombinant protein of human sterile alpha motif and leucine zipper containing kinase AZK (ZAK), transcript variant 2
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200069 protein sequence
Red=Cloning site Green=Tags(s) MSSLGASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVLSHRNIIQFYG VILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVV IAADGVLKICDFGASRFHNHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLE GLQVAWLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNK AEWRCEIEATLERLKKLERDLSFKEQELKERERRLKMWEQKLTEQSNTPLLLPLAARMSEESYFESKTEE SNSAEMSCQITATSNGEGHGMNPSLQAMMLMGFGDIFSMNKAGAVMHSGMQINMQAKQNSSKTTSKRRGK KVNMALGFSDFDLSEGDDDDDDDGEEEDNDMDNSE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 51.4 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_598407 |
Locus ID | 51776 |
UniProt ID | Q9NYL2, D4Q8H0 |
Cytogenetics | 2q31.1 |
Refseq Size | 7194 |
Refseq ORF | 1365 |
Synonyms | AZK; CNM6; MLK7; mlklak; MLT; MLTK; MLTKalpha; MLTKbeta; MRK; pk; SFMMP; ZAK |
Summary | This gene is a member of the MAPKKK family of signal transduction molecules and encodes a protein with an N-terminal kinase catalytic domain, followed by a leucine zipper motif and a sterile-alpha motif (SAM). This magnesium-binding protein forms homodimers and is located in the cytoplasm. The protein mediates gamma radiation signaling leading to cell cycle arrest and activity of this protein plays a role in cell cycle checkpoint regulation in cells. The protein also has pro-apoptotic activity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | MAPK signaling pathway, Tight junction |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408752 | ZAK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC413852 | ZAK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC429511 | ZAK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LY408752 | Transient overexpression lysate of sterile alpha motif and leucine zipper containing kinase AZK (ZAK), transcript variant 2 |
USD 325.00 |
|
LY413852 | Transient overexpression lysate of sterile alpha motif and leucine zipper containing kinase AZK (ZAK), transcript variant 1 |
USD 495.00 |
|
LY429511 | Transient overexpression lysate of sterile alpha motif and leucine zipper containing kinase AZK (ZAK), transcript variant 1 |
USD 495.00 |
|
PH300069 | ZAK MS Standard C13 and N15-labeled recombinant protein (NP_598407) |
USD 2,055.00 |
|
PH321970 | ZAK MS Standard C13 and N15-labeled recombinant protein (NP_057737) |
USD 2,055.00 |
|
TP321970 | Recombinant protein of human sterile alpha motif and leucine zipper containing kinase AZK (ZAK), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review