ADI1 (NM_018269) Human Recombinant Protein

CAT#: TP300115

Recombinant protein of human acireductone dioxygenase 1 (ADI1)

Product Images

Coomassie blue staining of purified ADI1 protein (Cat# TP300115). The protein was produced from HEK293T cells transfected with ADI1 cDNA clone (Cat# RC200115) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200115 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNYSWMDIITIC
  KDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEK
  NYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 21.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_060739
• Locus ID: 55256
• UniProt ID: Q9BV57
• Cytogenetics: 2p25.3
• Refseq Size: 1685
• Refseq ORF: 537
• Synonyms: APL1; ARD; Fe-ARD; HMFT1638; MTCBP1; mtnD; Ni-ARD; SIPL
• Summary: This gene encodes an enzyme that belongs to the aci-reductone dioxygenase family of metal-binding enzymes, which are involved in methionine salvage. This enzyme may regulate mRNA processing in the nucleus, and may carry out different functions depending on its localization. Related pseudogenes have been defined on chromosomes 8 and 20. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2015]
• Protein Pathways: Cysteine and methionine metabolism, Metabolic pathways