SMOX (NM_175840) Human Recombinant Protein
CAT#: TP300156
Recombinant protein of human spermine oxidase (SMOX), transcript variant 2
View other "SMOX" proteins (11)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200156 protein sequence
Red=Cloning site Green=Tags(s) MQSCESSGDSADDPLSRGLRRRGQPRVVVIGAGLAGLAAAKALLEQGFTDVTVLEASSHIGGRVQSVKLG HATFELGATWIHGSHGNPIYHLAEANGLLEETTDGERSVGRISLYSKNGVACYLTNHGRRIPKDVVEEFS DLYNEVYNLTQEFFRHDKPVNAESQNSVGVFTREEVRNRIRNDPDDPEATKRLKLAMIQQYLKVESCESS SHSMDEVSLSAFGEWTEIPGAHHIIPSGFMRVVELLAEGIPAHVIQLGKPVRCIHWDQASARPRGPEIEP RGVLKRQYTSFFRPGLPTEKVAAIHRLGIGTTDKIFLEFEEPFWGPECNSLQFVWEDEAESHTLTYPPEL WYRKICGFDVLYPPERYGHVLSGWICGEEALVMEKCDDEAVAEICTEMLRQFTGNPNIPKPRRILRSAWG SNPYFRGSYSYTQVGSSGADVEKLAKPLPYTESSKTAPMQVLFSGEATHRKYYSTTHGALLSGQREAARL IEMYRDLFQQGT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 55.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_787034 |
Locus ID | 54498 |
UniProt ID | Q9NWM0 |
Cytogenetics | 20p13 |
Refseq Size | 2090 |
Refseq ORF | 1506 |
Synonyms | C20orf16; PAO; PAO-1; PAO1; PAOH; PAOH1; SMO |
Summary | Polyamines are ubiquitous polycationic alkylamines which include spermine, spermidine, putrescine, and agmatine. These molecules participate in a broad range of cellular functions which include cell cycle modulation, scavenging reactive oxygen species, and the control of gene expression. These molecules also play important roles in neurotransmission through their regulation of cell-surface receptor activity, involvement in intracellular signalling pathways, and their putative roles as neurotransmitters. This gene encodes an FAD-containing enzyme that catalyzes the oxidation of spermine to spermadine and secondarily produces hydrogen peroxide. Multiple transcript variants encoding different isoenzymes have been identified for this gene, some of which have failed to demonstrate significant oxidase activity on natural polyamine substrates. The characterized isoenzymes have distinctive biochemical characteristics and substrate specificities, suggesting the existence of additional levels of complexity in polyamine catabolism. [provided by RefSeq, Jul 2012] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406223 | SMOX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC406224 | SMOX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC406226 | SMOX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC430439 | SMOX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430441 | SMOX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY406223 | Transient overexpression lysate of spermine oxidase (SMOX), transcript variant 1 |
USD 605.00 |
|
LY406224 | Transient overexpression lysate of spermine oxidase (SMOX), transcript variant 2 |
USD 396.00 |
|
LY406226 | Transient overexpression lysate of spermine oxidase (SMOX), transcript variant 4 |
USD 605.00 |
|
LY430439 | Transient overexpression lysate of spermine oxidase (SMOX), transcript variant 1 |
USD 396.00 |
|
LY430441 | Transient overexpression lysate of spermine oxidase (SMOX), transcript variant 4 |
USD 396.00 |
|
PH300156 | SMOX MS Standard C13 and N15-labeled recombinant protein (NP_787034) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review