MDH1 (NM_005917) Human Recombinant Protein
CAT#: TP300298
Recombinant protein of human malate dehydrogenase 1, NAD (soluble) (MDH1)
View other "MDH1" proteins (6)
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200298 protein sequence
Red=Cloning site Green=Tags(s) MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIA TDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTA SKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVY EALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGV PDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 36.2 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005908 |
Locus ID | 4190 |
UniProt ID | P40925, V9HWF2 |
Cytogenetics | 2p15 |
Refseq Size | 1665 |
Refseq ORF | 1002 |
Synonyms | DEE88; EIEE88; HEL-S-32; KAR; MDH-s; MDHA; MGC:1375; MOR2 |
Summary | This gene encodes an enzyme that catalyzes the NAD/NADH-dependent, reversible oxidation of malate to oxaloacetate in many metabolic pathways, including the citric acid cycle. Two main isozymes are known to exist in eukaryotic cells: one is found in the mitochondrial matrix and the other in the cytoplasm. This gene encodes the cytosolic isozyme, which plays a key role in the malate-aspartate shuttle that allows malate to pass through the mitochondrial membrane to be transformed into oxaloacetate for further cellular processes. Alternatively spliced transcript variants have been found for this gene. A recent study showed that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is localized in the peroxisomes. Pseudogenes have been identified on chromosomes X and 6. [provided by RefSeq, Feb 2016] |
Protein Families | Druggable Genome |
Protein Pathways | Citrate cycle (TCA cycle), Glyoxylate and dicarboxylate metabolism, Metabolic pathways, Pyruvate metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401788 | MDH1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC434177 | MDH1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401788 | Transient overexpression lysate of malate dehydrogenase 1, NAD (soluble) (MDH1) |
USD 396.00 |
|
LY434177 | Transient overexpression lysate of malate dehydrogenase 1, NAD (soluble) (MDH1), transcript variant 1 |
USD 396.00 |
|
PH300298 | MDH1 MS Standard C13 and N15-labeled recombinant protein (NP_005908) |
USD 2,055.00 |
|
TP720248 | Recombinant protein of human malate dehydrogenase 1, NAD (soluble) (MDH1), transcript variant 1. |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review