DUSP14 (NM_007026) Human Recombinant Protein

CAT#: TP300531

Recombinant protein of human dual specificity phosphatase 14 (DUSP14)

Product Images

Coomassie blue staining of purified DUSP14 protein (Cat# TP300531). The protein was produced from HEK293T cells transfected with DUSP14 cDNA clone (Cat# RC200531) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200531 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQ
  FEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNW
  VKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 22.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_008957
• Locus ID: 11072
• UniProt ID: O95147, Q6FI36
• Cytogenetics: 17q12
• Refseq Size: 1508
• Refseq ORF: 594
• Synonyms: MKP-L; MKP6
• Summary: Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-based protein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosine and serine/threonine residues. They have been implicated as major modulators of critical signaling pathways. DUSP14 contains the consensus DUSP C-terminal catalytic domain but lacks the N-terminal CH2 domain found in the MKP (mitogen-activated protein kinase phosphatase) class of DUSPs (see MIM 600714) (summary by Patterson et al., 2009 [PubMed 19228121]).[supplied by OMIM, Dec 2009]
• Protein Families: Druggable Genome, Phosphatase
• Protein Pathways: MAPK signaling pathway