DDX17 (NM_006386) Human Recombinant Protein
CAT#: TP300599
Purified recombinant protein of Homo sapiens DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 (DDX17), transcript variant 1
View other "DDX17" proteins (6)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200599 representing NM_006386
Red=Cloning site Green=Tags(s) LPTGFVAPILCVLLPSPTREAATVASATGDSASERESAAPAAAPTAEAPPPSVVTRPEPQALPSPAIRAP LPDLYPFGTMRGGGFGDRDRDRDRGGFGARGGGGLPPKKFGNPGERLRKKKWDLSELPKFEKNFYVEHPE VARLTPYEVDELRRKKEITVRGGDVCPKPVFAFHHANFPQYVMDVLMDQHFTEPTPIQCQGFPLALSGRD MVGIAQTGSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTCIYG GAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDR QTLMWSATWPKEVRQLAEDFLRDYTQINVGNLELSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENK TIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFV INYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQLVDHRGGGGG GGGRSRYRTTSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGYGSPNSAFGAQA GQYTYGQGTYGAAAYGTSSYTAQEYGAGTYGASSTTSTGRSSQSSSQQFSGIGRSGQQPQPLMSQQFAQP PGATNMIGYMGQTAYQYPPPPPPPPPSRK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 80.1 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006377 |
Locus ID | 10521 |
UniProt ID | Q92841 |
Cytogenetics | 22q13.1 |
Refseq Size | 4805 |
Refseq ORF | 2187 |
Synonyms | P72; RH70 |
Summary | DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and splicesosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is an ATPase activated by a variety of RNA species, but not by dsDNA. This protein, and that encoded by DDX5 gene, are more closely related to each other than to any other member of the DEAD box family. This gene can encode multiple isoforms due to both alternative splicing and the use of alternative translation initiation codons, including a non-AUG (CUG) start codon. [provided by RefSeq, Apr 2011] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416678 | DDX17 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC429293 | DDX17 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY416678 | Transient overexpression lysate of DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 (DDX17), transcript variant 1 |
USD 396.00 |
|
LY429293 | Transient overexpression lysate of DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 (DDX17), transcript variant 1 |
USD 605.00 |
|
PH300599 | DDX17 MS Standard C13 and N15-labeled recombinant protein (NP_006377) |
USD 2,055.00 |
|
TP323076 | Recombinant protein of human DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 (DDX17), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review