S100A11 (NM_005620) Human Recombinant Protein
CAT#: TP300656
Recombinant protein of human S100 calcium binding protein A11 (S100A11)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200656 protein sequence
Red=Cloning site Green=Tags(s) MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTN SDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.6 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005611 |
Locus ID | 6282 |
UniProt ID | P31949, V9HWH9 |
Cytogenetics | 1q21.3 |
Refseq Size | 595 |
Refseq ORF | 315 |
Synonyms | HEL-S-43; MLN70; S100C |
Summary | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417184 | S100A11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY417184 | Transient overexpression lysate of S100 calcium binding protein A11 (S100A11) |
USD 325.00 |
|
PH300656 | S100A11 MS Standard C13 and N15-labeled recombinant protein (NP_005611) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review