TGF beta induced factor 2 (TGIF2) (NM_021809) Human Recombinant Protein

CAT#: TP300773

Recombinant protein of human TGFB-induced factor homeobox 2 (TGIF2)

Product Images

Coomassie blue staining of purified TGIF2 protein (Cat# TP300773). The protein was produced from HEK293T cells transfected with TGIF2 cDNA clone (Cat# RC200773) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200773 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFI
  NARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSGQGE
  KPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAA
  EMELQKQQDPSLPLLHTPIPLVSENPQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 25.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_068581
• Locus ID: 60436
• UniProt ID: Q9GZN2
• Cytogenetics: 20q11.23
• Refseq Size: 3415
• Refseq ORF: 711
• Summary: The protein encoded by this gene is a DNA-binding homeobox protein and a transcriptional repressor, which appears to repress transcription by recruiting histone deacetylases to TGF beta-responsive genes. This gene is amplified and over-expressed in some ovarian cancers. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 1. Read-through transcription also exists between this gene and the neighboring downstream C20orf24 (chromosome 20 open reading frame 24) gene. [provided by RefSeq, Dec 2010]
• Protein Families: Transcription Factors