CUEDC2 (NM_024040) Human Recombinant Protein
CAT#: TP300790
Recombinant protein of human CUE domain containing 2 (CUEDC2)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200790 protein sequence
Red=Cloning site Green=Tags(s) MELERIVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEMMEAYVPGFAH IPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPISPEPLQRPEMLKEETRSSAAAAADTQDEATG AEEELLPGVDVLLEVFPTCSVEQAQWVLAKARGDLEEAVQMLVEGKEEGPAAWEGPNQDLPRRLRGPQKD ELKSFILQKYMMVDSA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.8 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_076945 |
Locus ID | 79004 |
UniProt ID | Q9H467 |
Cytogenetics | 10q24.32 |
Refseq Size | 1203 |
Refseq ORF | 678 |
Synonyms | bA18I14.5; C10orf66 |
Summary | Down-regulates ESR1 protein levels through the ubiquitination-proteasome pathway, regardless of the presence of 17 beta-estradiol. Also involved in 17 beta-estradiol-induced ESR1 degradation. Controls PGR protein levels through a similar mechanism.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411416 | CUEDC2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY411416 | Transient overexpression lysate of CUE domain containing 2 (CUEDC2) |
USD 325.00 |
|
PH300790 | CUEDC2 MS Standard C13 and N15-labeled recombinant protein (NP_076945) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review