POLR2F (NM_021974) Human Recombinant Protein
CAT#: TP300855
Recombinant protein of human polymerase (RNA) II (DNA directed) polypeptide F (POLR2F)
View other "POLR2F" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200855 protein sequence
Red=Cloning site Green=Tags(s) MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRA LQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_068809 |
Locus ID | 5435 |
UniProt ID | P61218 |
Cytogenetics | 22q13.1 |
Refseq Size | 2109 |
Refseq ORF | 381 |
Synonyms | HRBP14.4; POLRF; RPABC2; RPABC14.4; RPB6; RPB14.4; RPC15 |
Summary | This gene encodes the sixth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. In yeast, this polymerase subunit, in combination with at least two other subunits, forms a structure that stabilizes the transcribing polymerase on the DNA template. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
Protein Families | Transcription Factors |
Protein Pathways | Huntington's disease, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411849 | POLR2F HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY411849 | Transient overexpression lysate of polymerase (RNA) II (DNA directed) polypeptide F (POLR2F) |
USD 396.00 |
|
PH300855 | POLR2F MS Standard C13 and N15-labeled recombinant protein (NP_068809) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review