RMND5B (NM_022762) Human Recombinant Protein
CAT#: TP300863
Recombinant protein of human required for meiotic nuclear division 5 homolog B (S. cerevisiae) (RMND5B)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200863 protein sequence
Red=Cloning site Green=Tags(s) MEQCACVERELDKVLQKFLTYGQHCERSLEELLHYVGQLRAELASAALQGTPLSATLSLVMSQCCRKIKD TVQKLASDHKDIHSSVSRVGKAIDRNFDSEICGVVSDAVWDAREQQQQILQMAIVEHLYQQGMLSVAEEL CQESTLNVDLDFKQPFLELNRILEALHEQDLGPALEWAVSHRQRLLELNSSLEFKLHRLHFIRLLAGGPA KQLEALSYARHFQPFARLHQREIQVMMGSLVYLRLGLEKSPYCHLLDSSHWAEICETFTRDACSLLGLSV ESPLSVSFASGCVALPVLMNIKAVIEQRQCTGVWNHKDELPIEIELGMKCWYHSVFACPILRQQTSDSNP PIKLICGHVISRDALNKLINGGKLKCPYCPMEQNPADGKRIIF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44.2 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_073599 |
Locus ID | 64777 |
UniProt ID | Q96G75 |
Cytogenetics | 5q35.3 |
Refseq Size | 1984 |
Refseq ORF | 1179 |
Synonyms | GID2; GID2B |
Summary | Core component of the CTLH E3 ubiquitin-protein ligase complex that selectively accepts ubiquitin from UBE2H and mediates ubiquitination and subsequent proteasomal degradation of the transcription factor HBP1. MAEA and RMND5A are both required for catalytic activity of the CTLH E3 ubiquitin-protein ligase complex (PubMed:29911972). Catalytic activity of the complex is required for normal cell proliferation (PubMed:29911972). The CTLH E3 ubiquitin-protein ligase complex is not required for the degradation of enzymes involved in gluconeogenesis, such as FBP1 (PubMed:29911972).[UniProtKB/Swiss-Prot Function] |
Protein Families | Stem cell - Pluripotency |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411580 | RMND5B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY411580 | Transient overexpression lysate of required for meiotic nuclear division 5 homolog B (S. cerevisiae) (RMND5B) |
USD 325.00 |
|
PH300863 | RMND5B MS Standard C13 and N15-labeled recombinant protein (NP_073599) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review