CMTM6 (NM_017801) Human Recombinant Protein

CAT#: TP301061

Recombinant protein of human CKLF-like MARVEL transmembrane domain containing 6 (CMTM6)

Product Images

Coomassie blue staining of purified CMTM6 protein (Cat# TP301061). The protein was produced from HEK293T cells transfected with CMTM6 cDNA clone (Cat# RC201061) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201061 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MENGAVYSPTTEEDPGPARGPRSGLAAYFFMGRLPLLRRVLKGLQLLLSLLAFICEEVVSQCTLCGGLYF
  FEFVSCSAFLLSLLILIVYCTPFYERVDTTKVKSSDFYITLGTGCVFLLASIIFVSTHDRTSAEIAAIVF
  GFIASFMFLLDFITMLYEKRQESQLRKPENTTRAEALTEPLNA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_060271
• Locus ID: 54918
• UniProt ID: Q9NX76
• Cytogenetics: 3p22.3
• Refseq Size: 3384
• Refseq ORF: 549
• Synonyms: CKLFSF6; PRO2219
• Summary: This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is widely expressed in many tissues, but the exact function of the encoded protein is unknown. [provided by RefSeq, Jul 2008]
• Protein Families: Transmembrane