APPD (PLEKHF1) (NM_024310) Human Recombinant Protein

CAT#: TP301282

Recombinant protein of human pleckstrin homology domain containing, family F (with FYVE domain) member 1 (PLEKHF1)

Product Images

Coomassie blue staining of purified PLEKHF1 protein (Cat# TP301282). The protein was produced from HEK293T cells transfected with PLEKHF1 cDNA clone (Cat# RC201282) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201282 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVDHLANTEINSQRIAAVESCFGASGQPLALPGRVLLGEGVLTKECRKKAKPRIFFLFNDILVYGSIVLN
  KRKYRSQHIIPLEEVTLELLPETLQAKNRWMIKTAKKSFVVSAASATERQEWISHIEECVRRQLRATGRP
  PSTEHAAPWIPDKATDICMRCTQTRFSALTRRHHCRKCGFVVCAECSRQRFLLPRLSPKPVRVCSLCYRE
  LAAQQRQEEAEEQGAGSPGQPAHLARPICGASSGDDDDSDEDKEGSRDGDWPSSVEFYASGVAWSAFHS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 31 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_077286
• Locus ID: 79156
• UniProt ID: Q96S99, Q96K11
• Cytogenetics: 19q12
• Refseq Size: 1774
• Refseq ORF: 837
• Synonyms: APPD; LAPF; PHAFIN1; ZFYVE15
• Summary: May induce apoptosis through the lysosomal-mitochondrial pathway. Translocates to the lysosome initiating the permeabilization of lysosomal membrane (LMP) and resulting in the release of CTSD and CTSL to the cytoplasm. Triggers the caspase-independent apoptosis by altering mitochondrial membrane permeabilization (MMP) resulting in the release of PDCD8.[UniProtKB/Swiss-Prot Function]