HENMT1 (NM_144584) Human Recombinant Protein
CAT#: TP301373
Recombinant protein of human chromosome 1 open reading frame 59 (C1orf59), transcript variant 1
View other "HENMT1" proteins (9)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201373 protein sequence
Red=Cloning site Green=Tags(s) MEENNLQCSSVVDGNFEEVPRETAIQFKPPLYRQRYQFVKNLVDQHEPKKVADLGCGDTSLLRLLKVNPC IELLVGVDINEDKLRWRGDSLAPFLGDFLKPRDLNLTITLYHGSVVERDSRLLGFDLITCIELIEHLDSG DLARFPEVVFGYLSPSMIVISTPNSEFNPLFPSVTLRDSDHKFEWTRMEFQTWALYVANRYDYSVEFTGV GEPPAGAENVGYCTQIGIFRKNGGKATESCLSEQHDQHVYKAVFTTSYPSLQQERFFKLVLVNEVSQQVE SLRVSHLPRRKEQAGERGDKPKDIGGSKAPVPCFGPVFTEVEKAKIENSPTPFCVGDKFFVPLQRLLAYP KLNRLCANEEIMRSVIADSIPLSSDGSAVVADLRNYFDEQFEF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_653185 |
Locus ID | 113802 |
UniProt ID | Q5T8I9 |
Cytogenetics | 1p13.3 |
Refseq Size | 1890 |
Refseq ORF | 1179 |
Synonyms | C1orf59; HEN1 |
Summary | Methyltransferase that adds a 2'-O-methyl group at the 3'-end of piRNAs, a class of 24 to 30 nucleotide RNAs that are generated by a Dicer-independent mechanism and are primarily derived from transposons and other repeated sequence elements. This probably protects the 3'-end of piRNAs from uridylation activity and subsequent degradation. Stabilization of piRNAs is essential for gametogenesis.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408292 | HENMT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC420162 | HENMT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426186 | HENMT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY408292 | Transient overexpression lysate of chromosome 1 open reading frame 59 (C1orf59), transcript variant 1 |
USD 396.00 |
|
LY420162 | Transient overexpression lysate of chromosome 1 open reading frame 59 (C1orf59), transcript variant 2 |
USD 396.00 |
|
LY426186 | Transient overexpression lysate of chromosome 1 open reading frame 59 (C1orf59), transcript variant 2 |
USD 396.00 |
|
PH301373 | C1orf59 MS Standard C13 and N15-labeled recombinant protein (NP_653185) |
USD 2,055.00 |
|
PH312823 | C1orf59 MS Standard C13 and N15-labeled recombinant protein (NP_001096062) |
USD 2,055.00 |
|
TP312823 | Purified recombinant protein of Homo sapiens chromosome 1 open reading frame 59 (C1orf59), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review