NAP1L4 (NM_005969) Human Recombinant Protein
CAT#: TP301407
Recombinant protein of human nucleosome assembly protein 1-like 4 (NAP1L4)
View other "NAP1L4" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201407 protein sequence
Red=Cloning site Green=Tags(s) MADHSFSDGVPSDSVEAAKNASNTEKLTDQVMQNPRVLAALQERLDNVPHTPSSYIETLPKAVKRRINAL KQLQVRCAHIEAKFYEEVHDLERKYAALYQPLFDKRREFITGDVEPTDAESEWHSENEEEEKLAGDMKSK VVVTEKAAATAEEPDPKGIPEFWFTIFRNVDMLSELVQEYDEPILKHLQDIKVKFSDPGQPMSFVLEFHF EPNDYFTNSVLTKTYKMKSEPDKADPFSFEGPEIVDCDGCTIDWKKGKNVTVKTIKKKQKHKGRGTVRTI TKQVPNESFFNFFNPLKASGDGESLDEDSEFTLASDFEIGHFFRERIVPRAVLYFTGEAIEDDDNFEEGE EGEEEELEGDEEGEDEDDAEINPKV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.6 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005960 |
Locus ID | 4676 |
UniProt ID | Q99733, A0A024RCC9 |
Cytogenetics | 11p15.4 |
Refseq Size | 2564 |
Refseq ORF | 1125 |
Synonyms | hNAP2; NAP1L4b; NAP2; NAP2L |
Summary | This gene encodes a member of the nucleosome assembly protein (NAP) family which can interact with both core and linker histones. It can shuttle between the cytoplasm and nucleus, suggesting a role as a histone chaperone. This gene is one of several located near the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416953 | NAP1L4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY416953 | Transient overexpression lysate of nucleosome assembly protein 1-like 4 (NAP1L4) |
USD 396.00 |
|
PH301407 | NAP1L4 MS Standard C13 and N15-labeled recombinant protein (NP_005960) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review