THEM2 (ACOT13) (NM_018473) Human Recombinant Protein

CAT#: TP301505

Recombinant protein of human thioesterase superfamily member 2 (THEM2)

Product Images

Coomassie blue staining of purified ACOT13 protein (Cat# TP301505). The protein was produced from HEK293T cells transfected with ACOT13 cDNA clone (Cat# RC201505) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201505 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTSMTQSLREVIKAMTKARNFERVLGKITLVSAAPGKVICEMKVEEEHTNAIGTLHGGLTATLVDNISTM
  ALLCTERGAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSVDLTNKATGKLIAQGRHTKHLGN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 14.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_060943
• Locus ID: 55856
• UniProt ID: Q9NPJ3
• Cytogenetics: 6p22.3
• Refseq Size: 4118
• Refseq ORF: 420
• Synonyms: HT012; PNAS-27; THEM2
• Summary: This gene encodes a member of the thioesterase superfamily. In humans, the protein co-localizes with microtubules and is essential for sustained cell proliferation. The orthologous mouse protein forms a homotetramer and is associated with mitochondria. The mouse protein functions as a medium- and long-chain acyl-CoA thioesterase. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, May 2009]