PGM3 (NM_015599) Human Recombinant Protein

CAT#: TP301522

Recombinant protein of human phosphoglucomutase 3 (PGM3)

Product Images

Coomassie blue staining of purified PGM3 protein (Cat# TP301522). The protein was produced from HEK293T cells transfected with PGM3 cDNA clone (Cat# RC201522) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201522 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDLGAITKYSALHAKPNGLILQYGTAGFRTKAEHLDHVMFRMGLLAVLRSKQTKSTIGVMVTASHNPEED
  NGVKLVDPLGEMLAPSWEEHATCLANAEEQDMQRVLIDISEKEAVNLQQDAFVVIGRDTRPSSEKLSQSV
  IDGVTVLGGQFHDYGLLTTPQLHYMVYCRNTGGRYGKATIEGYYQKLSKAFVELTKQASCSGDEYRSLKV
  DCANGIGALKLREMEHYFSQGLSVQLFNDGSKGKLNHLCGADFVKSHQKPPQGMEIKSNERCCSFDGDAD
  RIVYYYHDADGHFHLIDGDKIATLISSFLKELLVEIGESLNIGVVQTAYANGSSTRYLEEVMKVPVYCTK
  TGVKHLHHKAQEFDIGVYFEANGHGTALFSTAVEMKIKQSAEQLEDKKRKAAKMLENIIDLFNQAAGDAI
  SDMLVIEAILALKGLTVQQWDALYTDLPNRQLKVQVADRRVISTTNAERQAVTPPGLQEAINDLVKKYKL
  SRAFVRPSGTEDVVRVYAEADSQESADHLAHEVSLAVFQLAGGIGERPQPGF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 59.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_056414
• Locus ID: 5238
• UniProt ID: O95394
• Cytogenetics: 6q14.1
• Refseq Size: 6107
• Refseq ORF: 1626
• Synonyms: AGM1; IMD23; PAGM; PGM 3
• Summary: This gene encodes a member of the phosphohexose mutase family. The encoded protein mediates both glycogen formation and utilization by catalyzing the interconversion of glucose-1-phosphate and glucose-6-phosphate. A non-synonymous single nucleotide polymorphism in this gene may play a role in resistance to diabetic nephropathy and neuropathy. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2010]
• Protein Pathways: Amino sugar and nucleotide sugar metabolism