SSNA1 (NM_003731) Human Recombinant Protein

CAT#: TP301557

Recombinant protein of human Sjogren syndrome nuclear autoantigen 1 (SSNA1)


  View other "SSNA1" proteins (3)

USD 823.00

In Stock*

Size
    • 20 ug

Product Images

Frequently bought together (2)
Rabbit polyclonal SSNA1 Antibody (N-term)
    • 400 ul

USD 512.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00

Other products for "SSNA1"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC201557 protein sequence
Red=Cloning site Green=Tags(s)

MTQQGAALQNYNNELVKCIEELCQKREELCRQIQEEEDEKQRLQNEVRQLTEKLARVNENLARKIASRNE
FDRTIAETEAAYLKILESSQTLLSVLKREAGNLTKATAPDQKSSGGRDS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 13.4 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_003722
Locus ID 8636
UniProt ID O43805, A0A024R8G6
Cytogenetics 9q34.3
Refseq Size 954
Refseq ORF 357
Synonyms N14; NA-14; NA14

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.