TFB2M (NM_022366) Human Recombinant Protein

CAT#: TP301683

Recombinant protein of human transcription factor B2, mitochondrial (TFB2M), nuclear gene encoding mitochondrial protein

Product Images

Coomassie blue staining of purified TFB2M protein (Cat# TP301683). The protein was produced from HEK293T cells transfected with TFB2M cDNA clone (Cat# RC201683) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201683 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MWIPVVGLPRRLRLSALAGAGRFCILGSEAATRKHLPARNHCGLSDSSPQLWPEPDFRNPPRKASKASLD
  FKRYVTDRRLAETLAQIYLGKPSRPPHLLLECNPGPGILTQALLEAGAKVVALESDKTFIPHLESLGKNL
  DGKLRVIHCDFFKLDPRSGGVIKPPAMSSRGLFKNLGIEAVPWTADIPLKVVGMFPSRGEKRALWKLAYD
  LYSCTSIYKFGRIEVNMFIGEKEFQKLMADPGNPDLYHVLSVIWQLACEIKVLHMEPWSSFDIYTRKGPL
  ENPKRRELLDQLQQKLYLIQMIPRQNLFTKNLTPMNYNIFFHLLKHCFGRRSATVIDHLRSLTPLDARDI
  LMQIGKQEDEKVVNMHPQDFKTLFETIERSKDCAYKWLYDETLEDR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 45.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_071761
• Locus ID: 64216
• UniProt ID: Q9H5Q4
• Cytogenetics: 1q44
• Refseq Size: 1799
• Refseq ORF: 1188
• Synonyms: Hkp1; mtTFB2
• Summary: S-adenosyl-L-methionine-dependent methyltransferase which specifically dimethylates mitochondrial 12S rRNA at the conserved stem loop. Also required for basal transcription of mitochondrial DNA, probably via its interaction with POLRMT and TFAM. Stimulates transcription independently of the methyltransferase activity. Compared to TFB1M, it activates transcription of mitochondrial DNA more efficiently, while it has less methyltransferase activity.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transcription Factors