CRELD1 (NM_001031717) Human Recombinant Protein
CAT#: TP301774
Recombinant protein of human cysteine-rich with EGF-like domains 1 (CRELD1), transcript variant 1
View other "CRELD1" proteins (9)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201774 protein sequence
Red=Cloning site Green=Tags(s) MAPWPPKGLVPAVLWGLSLFLNLPGPIWLQPSPPPQSSPPPQPHPCHTCRGLVDSFNKGLERTIRDNFGG GNTAWEEENLSKYKDSETRLVEVLEGVCSKSDFECHRLLELSEELVESWWFHKQQEAPDLFQWLCSDSLK LCCPAGTFGPSCLPCPGGTERPCGGYGQCEGEGTRGGSGHCDCQAGYGGEACGQCGLGYFEAERNASHLV CSACFGPCARCSGPEESNCLQCKKGWALHHLKCVDIDECGTEGANCGADQFCVNTEGSYECRDCAKACLG CMGAGPGRCKKCSPGYQQVGSKCLDVDECETEVCPGENKQCENTEGGYRCICAEGYKQMEGICVKEQIPG AFPILTDLTPETTRRWKLGSHPHSTYVKMKMQRDEATFPGLYGKQVAKLGSQSRQSDRGTRLIHSQQASS QR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001026887 |
Locus ID | 78987 |
UniProt ID | Q96HD1 |
Cytogenetics | 3p25.3 |
Refseq Size | 2406 |
Refseq ORF | 1266 |
Synonyms | AVSD2; CIRRIN |
Summary | This gene encodes a member of a subfamily of epidermal growth factor-related proteins. The encoded protein is characterized by a cysteine-rich with epidermal growth factor-like domain. This protein may function as a cell adhesion molecule. Mutations in this gene are the cause of atrioventricular septal defect. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Apr 2010] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414506 | CRELD1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC421411 | CRELD1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC422168 | CRELD1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425847 | CRELD1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY414506 | Transient overexpression lysate of cysteine-rich with EGF-like domains 1 (CRELD1), transcript variant 2 |
USD 605.00 |
|
LY421411 | Transient overexpression lysate of cysteine-rich with EGF-like domains 1 (CRELD1), transcript variant 3 |
USD 605.00 |
|
LY422168 | Transient overexpression lysate of cysteine-rich with EGF-like domains 1 (CRELD1), transcript variant 1 |
USD 396.00 |
|
LY425847 | Transient overexpression lysate of cysteine-rich with EGF-like domains 1 (CRELD1), transcript variant 3 |
USD 396.00 |
|
PH301774 | CRELD1 MS Standard C13 and N15-labeled recombinant protein (NP_001026887) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review