C9orf6 (FAM206A) (NM_017832) Human Recombinant Protein
CAT#: TP301907
Recombinant protein of human chromosome 9 open reading frame 6 (C9orf6)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201907 protein sequence
Red=Cloning site Green=Tags(s) MATEPEAAEPVVPSLVDRYFTRWYKPDVKGKFCEDHCILQHSNRICVITLAESHPVLQSGKTIKSISYQI STNCSRLQNKVSGKFKRGAQFLTELAPLCKIYCSDGEEYTVSSCVRGRLMEVNENILHKPSILQEKPSTE GYIAVVLPKFEESKSITEGLLTQKQYEEVMVKRINATTATS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.2 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060302 |
Locus ID | 54942 |
UniProt ID | Q9NX38 |
Cytogenetics | 9q31.3 |
Refseq Size | 1925 |
Refseq ORF | 543 |
Synonyms | C9orf6; CG-8; FAM206A; Simiate |
Summary | Actin-binding protein that regulates actin polymerization, filopodia dynamics and increases the branching of proximal dendrites of developing neurons.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413506 | FAM206A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY413506 | Transient overexpression lysate of chromosome 9 open reading frame 6 (C9orf6) |
USD 325.00 |
|
PH301907 | C9orf6 MS Standard C13 and N15-labeled recombinant protein (NP_060302) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review