CPSF7 (NM_024811) Human Recombinant Protein
CAT#: TP302127
Recombinant protein of human pre-mRNA cleavage factor I, 59 kDa subunit (FLJ12529), transcript variant 1
View other "CPSF7" proteins (5)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202127 protein sequence
Red=Cloning site Green=Tags(s) MSEGVDLIDIYADEEFNQDPEFNNTDQIDLYDDVLTATSQPSDDRSSSTEPPPPVRQEPSPKPNNKTPAI LYTYSGLRNRRAAVYVGSFSWWTTDQQLIQVIRSIGVYDVVELKFAENRANGQSKGYAEVVVASENSVHK LLELLPGKVLNGEKVDVRPATRQNLSQFEAQARKRECVRVPRGGIPPRAHSRDSSDSADGRATPSENLVP SSARVDKPPSVLPYFNRPPSALPLMGLPPPPIPPPPPLSSSFGVPPPPPGIHYQHLMPPPPRLPPHLAVP PPGAIPPALHLNPAFFPPPNATVGPPPDTYMKASAPYNHHGSRDSGPPPSTVSEAEFEDIMKRNRAISSS AISKAVSGASAGDYSDAIETLLTAIAVIKQSRVANDERCRVLISSLKDCLHGIEAKSYSVGASGSSSRKR HRSRERSPSRSRESSRRHRDLLHNEDRHDDYFQERNREHERHRDRERDRHH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 51.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079087 |
Locus ID | 79869 |
UniProt ID | Q8N684 |
Cytogenetics | 11q12.2 |
Refseq Size | 3764 |
Refseq ORF | 1413 |
Synonyms | CFIm59 |
Summary | Cleavage factor Im (CFIm) is one of six factors necessary for correct cleavage and polyadenylation of pre-mRNAs. CFIm is composed of three different subunits of 25, 59, and 68 kDa, and it functions as a heterotetramer, with a dimer of the 25 kDa subunit binding to two of the 59 or 68 kDa subunits. The protein encoded by this gene represents the 59 kDa subunit, which can interact with the splicing factor U2 snRNP Auxiliary Factor (U2AF) 65 to link the splicing and polyadenylation complexes. [provided by RefSeq, Oct 2016] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411065 | CPSF7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC427787 | CPSF7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY411065 | Transient overexpression lysate of cleavage and polyadenylation specific factor 7, 59kDa (CPSF7), transcript variant 1 |
USD 396.00 |
|
LY427787 | Transient overexpression lysate of cleavage and polyadenylation specific factor 7, 59kDa (CPSF7), transcript variant 2 |
USD 396.00 |
|
PH302127 | CPSF7 MS Standard C13 and N15-labeled recombinant protein (NP_079087) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review