UBLCP1 (NM_145049) Human Recombinant Protein

CAT#: TP302342

Recombinant protein of human ubiquitin-like domain containing CTD phosphatase 1 (UBLCP1)

Product Images

Coomassie blue staining of purified UBLCP1 protein (Cat# TP302342). The protein was produced from HEK293T cells transfected with UBLCP1 cDNA clone (Cat# RC202342) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202342 representing NM_145049
  Red=Cloning site Green=Tags(s)
  
  MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVKLGALKLKPNT
  KIMMMGTREESLEDVLGPPPDNDDVVNDFDIEDEVVEVENREENLLKISRRVKEYKVEILNPPREGKKLL
  VLDVDYTLFDHRSCAETGVELMRPYLHEFLTSAYEDYDIVIWSATNMKWIEAKMKELGVSTNANYKITFM
  LDSAAMITVHTPRRGLIDVKPLGVIWGKFSEFYSKKNTIMFDDIGRNFLMNPQNGLKIRPFMKAHLNRDK
  DKELLKLTQYLKEIAKLDDFLDLNHKYWERYLSKKQGQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 36.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_659486
• Locus ID: 134510
• UniProt ID: Q8WVY7
• Cytogenetics: 5q33.3
• Refseq Size: 2178
• Refseq ORF: 954
• Synonyms: CPUB1
• Summary: Dephosphorylates 26S nuclear proteasomes, thereby decreasing their proteolytic activity. The dephosphorylation may prevent assembly of the core and regulatory particles (CP and RP) into mature 26S proteasome.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Protease