TRAP alpha (SSR1) (NM_003144) Human Recombinant Protein
CAT#: TP302408
Recombinant protein of human signal sequence receptor, alpha (SSR1)
USD 379.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202408 protein sequence
Red=Cloning site Green=Tags(s) MRLLPRLLLLLLLVFPATVLFRGGPRGLLAVAQDLTEDEETVEDSIIEDEDDEAEVEEDEPTDLVEDKEE EDVSGEPEASPSADTTILFVKGEDFPANNIVKFLVGFTNKGTEDFIVESLDASFRYPQDYQFYIQNFTAL PLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVTVIEREDGLDGETIFM YMFLAGLGLLVIVGLHQLLESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKR SVGSDE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32.1 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003135 |
Locus ID | 6745 |
UniProt ID | P43307 |
Cytogenetics | 6p24.3 |
Refseq Size | 9793 |
Refseq ORF | 858 |
Synonyms | TRAPA |
Summary | The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34-kD glycoprotein encoded by this gene and a 22-kD glycoprotein. This gene generates several mRNA species as a result of complex alternative polyadenylation. This gene is unusual in that it utilizes arrays of polyA signal sequences that are mostly non-canonical. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2014] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401093 | SSR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401093 | Transient overexpression lysate of signal sequence receptor, alpha (SSR1) |
USD 396.00 |
|
PH302408 | SSR1 MS Standard C13 and N15-labeled recombinant protein (NP_003135) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review