Caveolin 2 (CAV2) (NM_001233) Human Recombinant Protein

CAT#: TP302703

Recombinant protein of human caveolin 2 (CAV2), transcript variant 1

Product Images

Coomassie blue staining of purified CAV2 protein (Cat# TP302703). The protein was produced from HEK293T cells transfected with CAV2 cDNA clone (Cat# RC202703) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202703 representing NM_001233
  Red=Cloning site Green=Tags(s)
  
  MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIAEPVTTHSFDKVW
  ICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVKTCLMVLPSVQTIWKSVTDVI
  IAPLCTSVGRCFSSVSLQLSQD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 18.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001224
• Locus ID: 858
• UniProt ID: P51636, Q53X57
• Cytogenetics: 7q31.2
• Refseq Size: 3332
• Refseq ORF: 486
• Synonyms: CAV
• Summary: The protein encoded by this gene is a major component of the inner surface of caveolae, small invaginations of the plasma membrane, and is involved in essential cellular functions, including signal transduction, lipid metabolism, cellular growth control and apoptosis. This protein may function as a tumor suppressor. This gene and related family member (CAV1) are located next to each other on chromosome 7, and express colocalizing proteins that form a stable hetero-oligomeric complex. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. Additional isoforms resulting from the use of alternate in-frame translation initiation codons have also been described, and shown to have preferential localization in the cell (PMID:11238462). [provided by RefSeq, May 2011]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Focal adhesion