JM4 (PRAF2) (NM_007213) Human Recombinant Protein

CAT#: TP302910

Recombinant protein of human PRA1 domain family, member 2 (PRAF2)

Product Images

Coomassie blue staining of purified PRAF2 protein (Cat# TP302910). The protein was produced from HEK293T cells transfected with PRAF2 cDNA clone (Cat# RC202910) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202910 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSEVRLPPLRALDDFVLGSARLAAPDPCDPQRWCHRVINNLLYYQTNYLLCFGIGLALAGYVRPLHTLLS
  ALVVAVALGVLVWAAETRAAVRRCRRSHPAACLAAVLAVGLLVLWVAGGACTFLFSIAGPVLLILVHASL
  RLRNLKNKIENKIESIGLKRTPMGLLLEALGQEQEAGS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 19.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_009144
• Locus ID: 11230
• UniProt ID: O60831, A0A024QZ22
• Cytogenetics: Xp11.23
• Refseq Size: 1316
• Refseq ORF: 534
• Synonyms: JM4; Yip6a
• Summary: May be involved in ER/Golgi transport and vesicular traffic. Plays a proapoptotic role in cerulenin-induced neuroblastoma apoptosis.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane