C16orf13 (METTL26) (NM_001040161) Human Recombinant Protein
CAT#: TP303002
Recombinant protein of human chromosome 16 open reading frame 13 (C16orf13), transcript variant 3
View other "METTL26" proteins (9)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203002 protein sequence
Red=Cloning site Green=Tags(s) MLVAAAAERNKDPILHVLRQYLDPAQRGVRVLEVASGSGQHAAHFARAFPLAEWQPSDVDQRCLDRNPEW GLRDTALLEDLGKASGLLLERMVDMPANNKCLIFRKN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.8 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001035251 |
Locus ID | 84326 |
UniProt ID | Q96S19 |
Cytogenetics | 16p13.3 |
Refseq Size | 570 |
Refseq ORF | 321 |
Synonyms | C16orf13; JFP2 |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410160 | C16orf13 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC421703 | C16orf13 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC429803 | C16orf13 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY410160 | Transient overexpression lysate of chromosome 16 open reading frame 13 (C16orf13), transcript variant 1 |
USD 396.00 |
|
LY421703 | Transient overexpression lysate of chromosome 16 open reading frame 13 (C16orf13), transcript variant 3 |
USD 396.00 |
|
LY429803 | Transient overexpression lysate of chromosome 16 open reading frame 13 (C16orf13), transcript variant 1 |
USD 396.00 |
|
PH303002 | C16orf13 MS Standard C13 and N15-labeled recombinant protein (NP_001035251) |
USD 2,055.00 |
|
PH318337 | C16orf13 MS Standard C13 and N15-labeled recombinant protein (NP_115742) |
USD 2,055.00 |
|
TP318337 | Recombinant protein of human chromosome 16 open reading frame 13 (C16orf13), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review