MRP8 (S100A8) (NM_002964) Human Recombinant Protein

CAT#: TP303255

Purified recombinant protein of Homo sapiens S100 calcium binding protein A8 (S100A8)

Product Images

Coomassie blue staining of purified S100A8 protein (Cat# TP303255). The protein was produced from HEK293T cells transfected with S100A8 cDNA clone (Cat# RC203255) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203255 representing NM_002964
  Red=Cloning site Green=Tags(s)
  
  MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQE
  FLILVIKMGVAAHKKSHEESHKE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 10.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002955
• Locus ID: 6279
• UniProt ID: P05109
• Cytogenetics: 1q21.3
• Refseq Size: 532
• Refseq ORF: 279
• Synonyms: 60B8AG; CAGA; CFAG; CGLA; CP-10; L1Ag; MA387; MIF; MRP8; NIF; P8
• Summary: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2016]