SIKE1 (NM_025073) Human Recombinant Protein
CAT#: TP303262
Recombinant protein of human suppressor of IKK epsilon (SIKE), transcript variant 2
View other "SIKE1" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203262 protein sequence
Red=Cloning site Green=Tags(s) MSCTIEKILTDAKTLLERLREHDAAAESLVDQSAALHRRVAAMREAGTALPDQYQEDASDMKDMSKYKPH ILLSQENTQIRDLQQENRELWISLEEHQDALELIMSKYRKQMLQLMVAKKAVDAEPVLKAHQSHSAEIES QIDRICEMGEVMRKAVQVDDDQFCKIQEKLAQLELENKELRELLSISSESLQARKENSMDTASQAIK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079349 |
Locus ID | 80143 |
UniProt ID | Q9BRV8 |
Cytogenetics | 1p13.2 |
Refseq Size | 5507 |
Refseq ORF | 621 |
Synonyms | SIKE |
Summary | SIKE interacts with IKK-epsilon (IKBKE; MIM 605048) and TBK1 (MIM 604834) and acts as a suppressor of TLR3 (MIM 603029) and virus-triggered interferon activation pathways (Huang et al., 2005 [PubMed 16281057]).[supplied by OMIM, Mar 2008] |
Protein Pathways | RIG-I-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410899 | SIKE1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY410899 | Transient overexpression lysate of suppressor of IKBKE 1 (SIKE1), transcript variant 2 |
USD 396.00 |
|
PH303262 | SIKE1 MS Standard C13 and N15-labeled recombinant protein (NP_079349) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review