VILIP3 (HPCAL1) (NM_134421) Human Recombinant Protein
CAT#: TP303476
Recombinant protein of human hippocalcin-like 1 (HPCAL1), transcript variant 2
View other "HPCAL1" proteins (8)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203476 protein sequence
Red=Cloning site Green=Tags(s) MGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKFAEHVFR TFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPE DESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.1 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_602293 |
Locus ID | 3241 |
UniProt ID | P37235, Q6FGY1, O75544 |
Cytogenetics | 2p25.1 |
Refseq Size | 1921 |
Refseq ORF | 579 |
Synonyms | BDR1; HLP2; VILIP-3 |
Summary | The protein encoded by this gene is a member of neuron-specific calcium-binding proteins family found in the retina and brain. It is highly similar to human hippocalcin protein and nearly identical to the rat and mouse hippocalcin like-1 proteins. It may be involved in the calcium-dependent regulation of rhodopsin phosphorylation and may be of relevance for neuronal signalling in the central nervous system. Several alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Apr 2012] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408747 | HPCAL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC419502 | HPCAL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY408747 | Transient overexpression lysate of hippocalcin-like 1 (HPCAL1), transcript variant 2 |
USD 396.00 |
|
LY419502 | Transient overexpression lysate of hippocalcin-like 1 (HPCAL1), transcript variant 1 |
USD 396.00 |
|
PH303476 | HPCAL1 MS Standard C13 and N15-labeled recombinant protein (NP_602293) |
USD 2,055.00 |
|
PH303570 | HPCAL1 MS Standard C13 and N15-labeled recombinant protein (NP_002140) |
USD 2,055.00 |
|
TP303570 | Recombinant protein of human hippocalcin-like 1 (HPCAL1), transcript variant 1 |
USD 823.00 |
|
TP720206 | Recombinant protein of human hippocalcin-like 1 (HPCAL1), transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review