Retinal protein 4 (UNC119) (NM_005148) Human Recombinant Protein
CAT#: TP303758
Recombinant protein of human unc-119 homolog (C. elegans) (UNC119), transcript variant 1
View other "UNC119" proteins (9)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203758 protein sequence
Red=Cloning site Green=Tags(s) MKVKKGGGGAGTATESAPGPSGQSVAPIPQPPAESESGSESEPDAGPGPRPGPLQRKQPIGPEDVLGLQR ITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRL RQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRH PYETQSDSFYFVDDRLVMHNKADYSYSGTP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.8 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005139 |
Locus ID | 9094 |
UniProt ID | Q13432 |
Cytogenetics | 17q11.2 |
Refseq Size | 1398 |
Refseq ORF | 720 |
Synonyms | HRG4; IMD13; POC7; POC7A |
Summary | This gene is specifically expressed in the photoreceptors in the retina. The encoded product shares strong homology with the C. elegans unc119 protein and it can functionally complement the C. elegans unc119 mutation. It has been localized to the photoreceptor synapses in the outer plexiform layer of the retina, and suggested to play a role in the mechanism of photoreceptor neurotransmitter release through the synaptic vesicle cycle. Two transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409279 | UNC119 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC417490 | UNC119 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC429914 | UNC119 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY409279 | Transient overexpression lysate of unc-119 homolog (C. elegans) (UNC119), transcript variant 2 |
USD 396.00 |
|
LY417490 | Transient overexpression lysate of unc-119 homolog (C. elegans) (UNC119), transcript variant 1 |
USD 396.00 |
|
LY429914 | Transient overexpression lysate of unc-119 homolog (C. elegans) (UNC119), transcript variant 2 |
USD 396.00 |
|
PH303758 | UNC119 MS Standard C13 and N15-labeled recombinant protein (NP_005139) |
USD 2,055.00 |
|
PH312513 | UNC119 MS Standard C13 and N15-labeled recombinant protein (NP_473376) |
USD 2,055.00 |
|
TP312513 | Purified recombinant protein of Homo sapiens unc-119 homolog (C. elegans) (UNC119), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review