TAF10 (NM_006284) Human Recombinant Protein
CAT#: TP304138
Recombinant protein of human TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa (TAF10)
View other "TAF10" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204138 protein sequence
Red=Cloning site Green=Tags(s) MSCSGSGADPEAAPASAASAPGPAPPVSAPAALPSSTAAENKASPAGTAGGPGAGAAAGGTGPLAARAGE PAERRGAAPVSAGGAAPPEGAISNGVYVLPSAANGDVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLN RAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGIN VKKPHYFT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006275 |
Locus ID | 6881 |
UniProt ID | Q12962 |
Cytogenetics | 11p15.4 |
Refseq Size | 834 |
Refseq ORF | 654 |
Synonyms | TAF2A; TAF2H; TAFII30 |
Summary | Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes one of the small subunits of TFIID that is associated with a subset of TFIID complexes. Studies with human and mammalian cells have shown that this subunit is required for transcriptional activation by the estrogen receptor, for progression through the cell cycle, and may also be required for certain cellular differentiation programs. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Basal transcription factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416752 | TAF10 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY416752 | Transient overexpression lysate of TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa (TAF10) |
USD 396.00 |
|
PH304138 | TAF10 MS Standard C13 and N15-labeled recombinant protein (NP_006275) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review