Dysbindin (DTNBP1) (NM_032122) Human Recombinant Protein
CAT#: TP304208
Recombinant protein of human dystrobrevin binding protein 1 (DTNBP1), transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204208 protein sequence
Red=Cloning site Green=Tags(s) MLETLRERLLSVQQDFTSGLKTLSDKSREAKVKSKPRTVPFLPKYSAGLELLSRYEDTWAALHRRAKDCA SAGELVDSEVVMLSAHWEKKKTSLVELQEQLQQLPALIADLESMTANLTHLEASFEEVENNLLHLEDLCG QCELERCKHMQSQQLENYKKNKRKELETFKAELDAEHAQKVLEMEHTQQMKLKERQKFFEEAFQQDMEQY LSTGYLQIAERREPIGSMSSMEVNVDMLEQMDLMDISDQEALDVFLNSGGEENTVLSPALGPESSTCQNE ITLQVPNPSELRAKPPSSSSTCTDSATRDISEGGESPVVQSDEEEVQVDTALATSHTDREATPDGGEDSD S myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_115498 |
Locus ID | 84062 |
UniProt ID | Q96EV8, A0A0S2Z5U8 |
Cytogenetics | 6p22.3 |
Refseq Size | 1429 |
Refseq ORF | 1053 |
Synonyms | BLOC1S8; DBND; HPS7; My031; SDY |
Summary | This gene encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. A similar protein in mouse is a component of a protein complex termed biogenesis of lysosome-related organelles complex 1 (BLOC-1), and binds to alpha- and beta-dystrobrevins, which are components of the dystrophin-associated protein complex (DPC). Mutations in this gene are associated with Hermansky-Pudlak syndrome type 7. This gene may also be associated with schizophrenia. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403167 | DTNBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC405212 | DTNBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC430642 | DTNBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY403167 | Transient overexpression lysate of dystrobrevin binding protein 1 (DTNBP1), transcript variant 1 |
USD 325.00 |
|
LY405212 | Transient overexpression lysate of dystrobrevin binding protein 1 (DTNBP1), transcript variant 2 |
USD 325.00 |
|
LY430642 | Transient overexpression lysate of dystrobrevin binding protein 1 (DTNBP1), transcript variant 2 |
USD 325.00 |
|
PH304208 | DTNBP1 MS Standard C13 and N15-labeled recombinant protein (NP_115498) |
USD 2,055.00 |
|
TP323289 | Recombinant protein of human dystrobrevin binding protein 1 (DTNBP1), transcript variant 3 |
USD 748.00 |
|
TP761501 | Purified recombinant protein of Human dystrobrevin binding protein 1 (DTNBP1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review