TAGLN3 (NM_013259) Human Recombinant Protein
CAT#: TP304424
Recombinant protein of human transgelin 3 (TAGLN3), transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204424 protein sequence
Red=Cloning site Green=Tags(s) MANRGPSYGLSREVQEKIEQKYDADLENKLVDWIILQCAEDIEHPPPGRAHFQKWLMDGTVLCKLINSLY PPGQEPIPKISESKMAFKQMEQISQFLKAAETYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTKD DGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGSNKGASQAGMTGYGMPRQIM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_037391 |
Locus ID | 29114 |
UniProt ID | Q9UI15 |
Cytogenetics | 3q13.2 |
Refseq Size | 1503 |
Refseq ORF | 597 |
Synonyms | NP22; NP24; NP25 |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415704 | TAGLN3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC423411 | TAGLN3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC423412 | TAGLN3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425232 | TAGLN3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425233 | TAGLN3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY415704 | Transient overexpression lysate of transgelin 3 (TAGLN3), transcript variant 1 |
USD 396.00 |
|
LY423411 | Transient overexpression lysate of transgelin 3 (TAGLN3), transcript variant 2 |
USD 396.00 |
|
LY423412 | Transient overexpression lysate of transgelin 3 (TAGLN3), transcript variant 3 |
USD 396.00 |
|
LY425232 | Transient overexpression lysate of transgelin 3 (TAGLN3), transcript variant 2 |
USD 396.00 |
|
LY425233 | Transient overexpression lysate of transgelin 3 (TAGLN3), transcript variant 3 |
USD 396.00 |
|
PH304424 | TAGLN3 MS Standard C13 and N15-labeled recombinant protein (NP_037391) |
USD 2,055.00 |
|
PH316395 | TAGLN3 MS Standard C13 and N15-labeled recombinant protein (NP_001008274) |
USD 2,055.00 |
|
PH323474 | TAGLN3 MS Standard C13 and N15-labeled recombinant protein (NP_001008273) |
USD 2,055.00 |
|
TP316395 | Recombinant protein of human transgelin 3 (TAGLN3), transcript variant 3 |
USD 748.00 |
|
TP323474 | Recombinant protein of human transgelin 3 (TAGLN3), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review