Alpha 1 Acid Glycoprotein (ORM1) (NM_000607) Human Recombinant Protein

CAT#: TP304629

Recombinant protein of human orosomucoid 1 (ORM1)

Product Images

Coomassie blue staining of purified ORM1 protein (Cat# TP304629). The protein was produced from HEK293T cells transfected with ORM1 cDNA clone (Cat# RC204629) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204629 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQEIQATFFYFT
  PNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNW
  GLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 21.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000598
• Locus ID: 5004
• UniProt ID: P02763
• Cytogenetics: 9q32
• Refseq Size: 847
• Refseq ORF: 603
• Synonyms: AGP-A; AGP1; HEL-S-153w; ORM
• Summary: This gene encodes a key acute phase plasma protein. Because of its increase due to acute inflammation, this protein is classified as an acute-phase reactant. The specific function of this protein has not yet been determined; however, it may be involved in aspects of immunosuppression. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Secreted Protein