Eotaxin (CCL11) (NM_002986) Human Recombinant Protein

CAT#: TP304726

Purified recombinant protein of Human chemokine (C-C motif) ligand 11 (CCL11), full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Purified recombinant protein CCL11 was analyzed by SDS-PAGE gel and Coomossie Blue Staining.

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204726 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKVSAALLWLLLIAAAFSPQGLAGPASVPTTCCFNLANRKIPLQRLESYRRITSGKCPQKAVIFKTKLAK
  DICADPKKKWVQDSMKYLDQKSPTPKP
  
  myc-FLAG tag
• Tag: Myc-DDK
• Predicted MW: 10.7 kDa
• Concentration: >50 ug/mL as determined by microplate Bradford method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25mM Tris-HCl, pH7.3, 100mM glycine, 10% glycerol
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for at least 1 year from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002977
• Locus ID: 6356
• UniProt ID: P51671, Q6I9T4
• Cytogenetics: 17q12
• Refseq Size: 925
• Refseq ORF: 291
• Synonyms: SCYA11
• Summary: This antimicrobial gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, displays chemotactic activity for eosinophils, but not mononuclear cells or neutrophils. This eosinophil-specific chemokine is thought to be involved in eosinophilic inflammatory diseases such as atopic dermatitis, allergic rhinitis, asthma and parasitic infections. [provided by RefSeq, Sep 2014]
• Protein Families: Druggable Genome, Secreted Protein, Transmembrane
• Protein Pathways: Asthma, Chemokine signaling pathway, Cytokine-cytokine receptor interaction, NOD-like receptor signaling pathway