Eotaxin (CCL11) (NM_002986) Human Recombinant Protein
CAT#: TP304726
Purified recombinant protein of Human chemokine (C-C motif) ligand 11 (CCL11), full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Other products for "CCL11"
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204726 protein sequence
Red=Cloning site Green=Tags(s) MKVSAALLWLLLIAAAFSPQGLAGPASVPTTCCFNLANRKIPLQRLESYRRITSGKCPQKAVIFKTKLAK DICADPKKKWVQDSMKYLDQKSPTPKP myc-FLAG tag |
Tag | Myc-DDK |
Predicted MW | 10.7 kDa |
Concentration | >50 ug/mL as determined by microplate Bradford method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25mM Tris-HCl, pH7.3, 100mM glycine, 10% glycerol |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for at least 1 year from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002977 |
Locus ID | 6356 |
UniProt ID | P51671, Q6I9T4 |
Cytogenetics | 17q12 |
Refseq Size | 925 |
Refseq ORF | 291 |
Synonyms | SCYA11 |
Summary | This antimicrobial gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, displays chemotactic activity for eosinophils, but not mononuclear cells or neutrophils. This eosinophil-specific chemokine is thought to be involved in eosinophilic inflammatory diseases such as atopic dermatitis, allergic rhinitis, asthma and parasitic infections. [provided by RefSeq, Sep 2014] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Asthma, Chemokine signaling pathway, Cytokine-cytokine receptor interaction, NOD-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.