Thymosin beta 10 (TMSB10) (NM_021103) Human Recombinant Protein
CAT#: TP305097
Recombinant protein of human thymosin beta 10 (TMSB10)
Frequently bought together (2)
Other products for "TMSB10"
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205097 protein sequence
Red=Cloning site Green=Tags(s) MADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 4.8 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_066926 |
Locus ID | 9168 |
UniProt ID | P63313 |
Cytogenetics | 2p11.2 |
Refseq Size | 482 |
Refseq ORF | 132 |
Synonyms | MIG12; TB10 |
Summary | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.