MANBAL (NM_022077) Human Recombinant Protein
CAT#: TP305099
Recombinant protein of human mannosidase, beta A, lysosomal-like (MANBAL), transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205099 protein sequence
Red=Cloning site Green=Tags(s) MASDLDFSPPEVPEPTFLENLLRYGLFLGAIFQLICVLAIIVPIPKSHEAEAEPSEPRSAEVTRKPKAAV PSVNKRPKKETKKKR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 9.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_071360 |
Locus ID | 63905 |
UniProt ID | Q9NQG1 |
Cytogenetics | 20q11.23 |
Refseq Size | 1385 |
Refseq ORF | 255 |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411800 | MANBAL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC424033 | MANBAL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY411800 | Transient overexpression lysate of mannosidase, beta A, lysosomal-like (MANBAL), transcript variant 1 |
USD 325.00 |
|
LY424033 | Transient overexpression lysate of mannosidase, beta A, lysosomal-like (MANBAL), transcript variant 2 |
USD 325.00 |
|
PH300796 | MANBAL MS Standard C13 and N15-labeled recombinant protein (NP_001003897) |
USD 2,055.00 |
|
PH305099 | MANBAL MS Standard C13 and N15-labeled recombinant protein (NP_071360) |
USD 2,055.00 |
|
TP300796 | Recombinant protein of human mannosidase, beta A, lysosomal-like (MANBAL), transcript variant 2 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review