RAB24 (NM_001031677) Human Recombinant Protein
CAT#: TP305647
Recombinant protein of human RAB24, member RAS oncogene family (RAB24), transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205647 protein sequence
Red=Cloning site Green=Tags(s) MSGQRVDVKVVMLGKEYVGKTSLVERYVHDRFLVGPYQNTIGAAFVAKVMSVGDRTVTLGIWDTAGSERY EAMSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKSDLLEEDRRRRRVDFHDVQ DYADNIKAQLFETSSKTGQSVDELFQKVAEDYVSVAAFQVMTEDKGVDLGQKPNPYFYSCCHH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001026847 |
Locus ID | 53917 |
UniProt ID | Q969Q5 |
Cytogenetics | 5q35.3 |
Refseq Size | 1632 |
Refseq ORF | 609 |
Summary | RAB24 is a small GTPase of the Rab subfamily of Ras-related proteins that regulate intracellular protein trafficking (Olkkonen et al., 1993 [PubMed 8126105]).[supplied by OMIM, Aug 2009] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408940 | RAB24 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC422221 | RAB24 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY408940 | Transient overexpression lysate of RAB24, member RAS oncogene family (RAB24), transcript variant 2 |
USD 325.00 |
|
LY422221 | Transient overexpression lysate of RAB24, member RAS oncogene family (RAB24), transcript variant 1 |
USD 325.00 |
|
PH302197 | RAB24 MS Standard C13 and N15-labeled recombinant protein (NP_570137) |
USD 2,055.00 |
|
PH305647 | RAB24 MS Standard C13 and N15-labeled recombinant protein (NP_001026847) |
USD 2,055.00 |
|
TP302197 | Recombinant protein of human RAB24, member RAS oncogene family (RAB24), transcript variant 2 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review