Epiphycan (EPYC) (NM_004950) Human Recombinant Protein
CAT#: TP305900
Recombinant protein of human epiphycan (EPYC)
View other "EPYC" proteins (4)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205900 representing NM_004950
Red=Cloning site Green=Tags(s) MKTLAGLVLGLVIFDAAVTAPTLESINYDSETYDATLEDLDNLYNYENIPVGKVEIEIATVMPSGNRELL TPPPQPEKAQEEEEEEESTPRLIDGSSPQEPEFTGVLGPHTNEDFPTCLLCTCISTTVYCDDHELDAIPP LPKNTAYFYSRFNRIKKINKNDFASLSDLKRIDLTSNLISEIDEDAFRKLPQLRELVLRDNKIRQLPELP TTLTFIDISNNRLGRKGIKQEAFKDMYDLHHLYLTDNNLDHIPLPLPENLRALHLQNNNILEMHEDTFCN VKNLTYIRKALEDIRLDGNPINLSKTPQAYMCLPRLPVGSLV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004941 |
Locus ID | 1833 |
UniProt ID | Q99645, A0A024RBC3 |
Cytogenetics | 12q21.33 |
Refseq Size | 1594 |
Refseq ORF | 966 |
Synonyms | DSPG3; Pg-Lb; PGLB; SLRR3B |
Summary | Dermatan sulfate proteoglycan 3 is a member of the small leucine-rich repeat proteoglycan family. This gene is composed of seven exons. It regulates fibrillogenesis by interacting with collagen fibrils and other extracellular matrix proteins. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417637 | EPYC HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY417637 | Transient overexpression lysate of epiphycan (EPYC) |
USD 396.00 |
|
PH305900 | EPYC MS Standard C13 and N15-labeled recombinant protein (NP_004941) |
USD 2,055.00 |
|
TP701052 | Purified recombinant protein of Human epiphycan (EPYC), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review