Epiphycan (EPYC) (NM_004950) Human Recombinant Protein

CAT#: TP305900

Recombinant protein of human epiphycan (EPYC)

Product Images

Coomassie blue staining of purified EPYC protein (Cat# TP305900). The protein was produced from HEK293T cells transfected with EPYC cDNA clone (Cat# RC205900) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205900 representing NM_004950
  Red=Cloning site Green=Tags(s)
  
  MKTLAGLVLGLVIFDAAVTAPTLESINYDSETYDATLEDLDNLYNYENIPVGKVEIEIATVMPSGNRELL
  TPPPQPEKAQEEEEEEESTPRLIDGSSPQEPEFTGVLGPHTNEDFPTCLLCTCISTTVYCDDHELDAIPP
  LPKNTAYFYSRFNRIKKINKNDFASLSDLKRIDLTSNLISEIDEDAFRKLPQLRELVLRDNKIRQLPELP
  TTLTFIDISNNRLGRKGIKQEAFKDMYDLHHLYLTDNNLDHIPLPLPENLRALHLQNNNILEMHEDTFCN
  VKNLTYIRKALEDIRLDGNPINLSKTPQAYMCLPRLPVGSLV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 34.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004941
• Locus ID: 1833
• UniProt ID: Q99645, A0A024RBC3
• Cytogenetics: 12q21.33
• Refseq Size: 1594
• Refseq ORF: 966
• Synonyms: DSPG3; Pg-Lb; PGLB; SLRR3B
• Summary: Dermatan sulfate proteoglycan 3 is a member of the small leucine-rich repeat proteoglycan family. This gene is composed of seven exons. It regulates fibrillogenesis by interacting with collagen fibrils and other extracellular matrix proteins. [provided by RefSeq, Jul 2008]
• Protein Families: Secreted Protein