MT1F (NM_005949) Human Recombinant Protein

CAT#: TP305931

Recombinant protein of human metallothionein 1F (MT1F)

Product Images

Coomassie blue staining of purified MT1F protein (Cat# TP305931). The protein was produced from HEK293T cells transfected with MT1F cDNA clone (Cat# RC205931) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205931 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSCCD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 5.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005940
• Locus ID: 4494
• UniProt ID: P04733
• Cytogenetics: 16q13
• Refseq Size: 456
• Refseq ORF: 183
• Synonyms: MT1
• Summary: Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.[UniProtKB/Swiss-Prot Function]