CaMKK (CAMKK1) (NM_172207) Human Recombinant Protein
CAT#: TP306389
Recombinant protein of human calcium/calmodulin-dependent protein kinase kinase 1, alpha (CAMKK1), transcript variant 3
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206389 protein sequence
Red=Cloning site Green=Tags(s) MEGGPAVCCQDPRAELVERVAAIDVTHLEEADGGPEPTRNGVDPPPRARAASVIPGSTSRLLPARPSLSA RKLSLQERPAGSYLEAQAGPYATGPASHISPRAWRRPTIESHHVAISDAEDCVQLNQYKLQSEIGKGAYG VVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPPRGSQAAQGGPAKQLLPLERVYQEIAILKKLDHVN VVKLIEVLDDPAEDNLYLALQNQAQNIQLDSTNIAKPHSLLPSEQQDSGSTWAARSVFDLLRKGPVMEVP CDKPFSEEQARLYLRDVILGLEYLHCQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQFEGNDAQLSSTAG TPAFMAPEAISDSGQSFSGKALDVWATGVTLYCFVYGKCPFIDDFILALHRKIKNEPVVFPEGPEISEEL KDLILKMLDKNPETRIGVPDIKLHPWVTKNGEEPLPSEEEHCSVVEVTEEEVKNSVRLIPSWTTVILVKS MLRKRSFGNPFEPQARREERSMSAPGNLLV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 57.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_757344 |
Locus ID | 84254 |
UniProt ID | Q8N5S9 |
Cytogenetics | 17p13.2 |
Refseq Size | 2535 |
Refseq ORF | 1560 |
Synonyms | CAMKKA |
Summary | The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This protein plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade. Three transcript variants encoding two distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Adipocytokine signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406737 | CAMKK1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC406738 | CAMKK1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC410237 | CAMKK1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC430358 | CAMKK1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY406737 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase kinase 1, alpha (CAMKK1), transcript variant 2 |
USD 495.00 |
|
LY406738 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase kinase 1, alpha (CAMKK1), transcript variant 3 |
USD 325.00 |
|
LY410237 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase kinase 1, alpha (CAMKK1), transcript variant 1 |
USD 325.00 |
|
LY430358 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase kinase 1, alpha (CAMKK1), transcript variant 2 |
USD 325.00 |
|
PH306389 | CAMKK1 MS Standard C13 and N15-labeled recombinant protein (NP_757344) |
USD 2,055.00 |
|
PH308102 | CAMKK1 MS Standard C13 and N15-labeled recombinant protein (NP_115670) |
USD 2,055.00 |
|
PH318931 | CAMKK1 MS Standard C13 and N15-labeled recombinant protein (NP_757343) |
USD 2,055.00 |
|
TP308102 | Recombinant protein of human calcium/calmodulin-dependent protein kinase kinase 1, alpha (CAMKK1), transcript variant 1 |
USD 823.00 |
|
TP318931 | Recombinant protein of human calcium/calmodulin-dependent protein kinase kinase 1, alpha (CAMKK1), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review