FGFBP2 (NM_031950) Human Recombinant Protein
CAT#: TP306392
Recombinant protein of human fibroblast growth factor binding protein 2 (FGFBP2)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206392 protein sequence
Red=Cloning site Green=Tags(s) MKFVPCLLLVTLSCLGTLGQAPRQKQGSTGEEFHFQTGGRDSCTMRPSSLGQGAGEVWLRVDCRNTDQTY WCEYRGQPSMCQAFAADPKPYWNQALQELRRLHHACQGAPVLRPSVCREAGPQAHMQQVTSSLKGSPEPN QQPEAGTPSLRPKATVKLTEATQLGKDSMEELGKAKPTTRPTAKPTQPGPRPGGNEEAKKKAWEHCWKPF QALCAFLISFFRG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_114156 |
Locus ID | 83888 |
UniProt ID | Q9BYJ0 |
Cytogenetics | 4p15.32 |
Refseq Size | 1188 |
Refseq ORF | 669 |
Synonyms | HBP17RP; KSP37 |
Summary | This gene encodes a member of the fibroblast growth factor binding protein family. The encoded protein is a serum protein that is selectively secreted by cytotoxic lymphocytes and may be involved in cytotoxic lymphocyte-mediated immunity. An increase in the amount of gene product may be associated with atopic asthma and mild extrinsic asthma.[provided by RefSeq Staff, Oct 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410396 | FGFBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY410396 | Transient overexpression lysate of fibroblast growth factor binding protein 2 (FGFBP2) |
USD 325.00 |
|
PH306392 | FGFBP2 MS Standard C13 and N15-labeled recombinant protein (NP_114156) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review