Carbonic Anhydrase XIV (CA14) (NM_012113) Human Recombinant Protein
CAT#: TP306503
Recombinant protein of human carbonic anhydrase XIV (CA14)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206503 protein sequence
Red=Cloning site Green=Tags(s) MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYD QPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYD SDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYF RYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQ AGSSYTTGEMLSLGVGILVGCLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036245 |
Locus ID | 23632 |
UniProt ID | Q9ULX7, A8K3J4 |
Cytogenetics | 1q21.2 |
Refseq Size | 1757 |
Refseq ORF | 1011 |
Synonyms | CAXiV |
Summary | Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA XIV is predicted to be a type I membrane protein and shares highest sequence similarity with the other transmembrane CA isoform, CA XII; however, they have different patterns of tissue-specific expression and thus may play different physiologic roles. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Nitrogen metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415966 | CA14 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY415966 | Transient overexpression lysate of carbonic anhydrase XIV (CA14) |
USD 325.00 |
|
PH306503 | CA14 MS Standard C13 and N15-labeled recombinant protein (NP_036245) |
USD 2,055.00 |
|
TP720955 | Purified recombinant protein of Human carbonic anhydrase XIV (CA14) |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review