Protein C (PROC) (NM_000312) Human Recombinant Protein

CAT#: TP306582

Recombinant protein of human protein C (inactivator of coagulation factors Va and VIIIa) (PROC)

Product Images

Coomassie blue staining of purified PROC protein (Cat# TP306582). The protein was produced from HEK293T cells transfected with PROC cDNA clone (Cat# RC206582) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206582 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRHSSLERECIEEICDFEEAK
  EIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSCDCRSGWEGRFCQREVSFLNC
  SLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVKFPCGRPWKRMEKKRSHLKRDTEDQEDQVDP
  RLIDGKMTRRGDSPWQVVLLDSKKKLACGAVLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDL
  DIKEVFVHPNYSKSTTDNDIALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREK
  EAKRNRTFVLNFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLV
  SWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAPQKSWAP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 50 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000303
• Locus ID: 5624
• UniProt ID: P04070
• Cytogenetics: 2q14.3
• Refseq Size: 1790
• Refseq ORF: 1383
• Synonyms: APC; PC; PROC1; THPH3; THPH4
• Summary: This gene encodes a vitamin K-dependent plasma glycoprotein. The encoded protein is cleaved to its activated form by the thrombin-thrombomodulin complex. This activated form contains a serine protease domain and functions in degradation of the activated forms of coagulation factors V and VIII. Mutations in this gene have been associated with thrombophilia due to protein C deficiency, neonatal purpura fulminans, and recurrent venous thrombosis.[provided by RefSeq, Dec 2009]
• Protein Families: Druggable Genome, Protease
• Protein Pathways: Complement and coagulation cascades