CNPY4 (NM_152755) Human Recombinant Protein

CAT#: TP307155

Recombinant protein of human canopy 4 homolog (zebrafish) (CNPY4)

Product Images

Coomassie blue staining of purified CNPY4 protein (Cat# TP307155). The protein was produced from HEK293T cells transfected with CNPY4 cDNA clone (Cat# RC207155) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207155 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGPVRLGILLFLFLAVHEAWAGMLKEEDDDTERLPSKCEVCKLLSTELQAELSRTGRSREVLELGQVLDT
  GKRKRHVPYSVSETRLEEALENLCERILDYSVHAERKGSLRYAKGQSQTMATLKGLVQKGVKVDLGIPLE
  LWDEPSVEVTYLKKQCETMLEEFEDIVGDWYFHHQEQPLQNFLCEGHVLPAAETACLQETWTGKEITDGE
  EKTEGEEEQEEEEEEEEEEGGDKMTKTGSHPKLDREDL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 28.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_689968
• Locus ID: 245812
• UniProt ID: Q8N129
• Cytogenetics: 7q22.1
• Refseq Size: 1547
• Refseq ORF: 744
• Synonyms: PRAT4B
• Summary: Plays a role in the regulation of the cell surface expression of TLR4.[UniProtKB/Swiss-Prot Function]