TMEFF1 (NM_003692) Human Recombinant Protein

CAT#: TP307212

Purified recombinant protein of Homo sapiens transmembrane protein with EGF-like and two follistatin-like domains 1 (TMEFF1)

Product Images

Coomassie blue staining of purified TMEFF1 protein (Cat# TP307212). The protein was produced from HEK293T cells transfected with TMEFF1 cDNA clone (Cat# RC207212) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207212 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGAAAAEAPLRLPAAPPLAFCCYTSVLLLFAFSLPGSRASNQPPGGGGGSGGDCPGGKGKSINCSELNVR
  ESDVRVCDESSCKYGGVCKEDGDGLKCACQFQCHTNYIPVCGSNGDTYQNECFLRRAACKHQKEITVIAR
  GPCYSDNGSGSGEGEEEGSGAEVHRKHSKCGPCKYKAECDEDAENVGCVCNIDCSGYSFNPVCASDGSSY
  NNPCFVREASCIKQEQIDIRHLGHCTDTDDTSLLGKKDDGLQYRPDVKDASDQREDVYIGNHMPCPENLN
  GYCIHGKCEFIYSTQKASCRCESGYTGQHCEKTDFSILYVVPSRQKLTHVLIAAIIGAVQIAIIVAIVMC
  ITRKCPKNNRGRRQKQNLGHFTSDTSSRMV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 40.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003683
• Locus ID: 8577
• UniProt ID: Q8IYR6
• Cytogenetics: 9q31.1
• Refseq Size: 2501
• Refseq ORF: 1140
• Synonyms: C9orf2; CT120.1; H7365; TR-1
• Summary: May inhibit NODAL and BMP signaling during neural patterning (By similarity). May be a tumor suppressor in brain cancers.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane